Krait bite poisoning in manipal region of Southern India.

Krait commonly inhabits the South Asian countries and is regarded as the most dangerous species of venomous snake in the Indian subcontinent. This prospective research included the consecutive cases of Krait bite cases admitted to Kasturba Hospital, Manipal during August 2003 and November 2005. All the victims of Krait bite were females aged between 17 and 35 years. Victims were from a rural background and most of them were bitten indoors and during the night time. Most of the bites involved the lower limbs. Signs of envenomation (neurological symptoms) were observed in 50% of the cases. In the only case of fatal outcome in our study, there was a delay in diagnosis of Krait bite owing to the absence of bite marks. The case emphasizes on the fact that the possibility of snake bite should be considered in an otherwise healthy person who presents with sudden onset of neuroparalytic features.

Purification and n-terminal sequencing of two presynaptic neurotoxic PLA2, neuwieditoxin-I and neuwieditoxin-II, from Bothrops neuwiedi pauloensis (jararaca pintada) venom

Two presynaptic phospholipases A2 (PLA2), neuwieditoxin-I (NeuTX-I) and neuwieditoxin-II (NeuTX-II), were isolated from the venom of Bothrops neuwiedi pauloensis (BNP). The venom was fractionated using molecular exclusion HPLC (Protein-Pak 300SW column), followed by reverse phase HPLC (æBondapak C18 column). Tricine-SDS-PAGE in the presence or absence of dithiothreitol showed that NeuTX-I and NeuTX-II had a molecular mass of approximately 14 kDa and 28kDa, respectively. At 10æg/ml, both toxins produced complete neuromuscular blockade in indirectly stimulated chick biventer cervicis isolated preparation without inhibiting the response to acetylcholine, but NeuTX-II reduced the response to KCl by 67.0±8.0 percent (n=3; p<0.05). NeuTX-I and NeuTX-II are probably responsible for the presynaptic neurotoxicity of BNP venom in vitro. In fact, using loose patch clamp technique for mouse phrenic nerve-diaphragm preparation, NeuTX-I produced a calcium-dependent blockade of acetylcholine release and caused appearance of giant miniature end-plate potentials (mepps), indicating a pure presynaptic action. The N-terminal sequence of NeuTX-I was DLVQFGQMILKVAGRSLPKSYGAYGCYCGWGGRGK (71 percent homology with bothropstoxin-II and 54 percent homology with caudoxin) and that of NeuTX-II was SLFEFAKMILEETKRLPFPYYGAYGCYCGWGGQGQPKDAT (92 percent homology with Basp-III and 62 percent homology with crotoxin PLA2). The fact that NeuTX-I has Q-4 (Gln-4) and both toxins have F-5 (Phe-5) and Y-28 (Tyr-28) strongly suggests that NeuTX-I and NeuTX-II are Asp49 PLA2.

Occurrence of tetrodotoxin and paralytic shellfish toxins in Phallusia nigra (Tunicata, Ascidiacea) from the brazilian coast

We have already shown the presence of guanidine neurotoxins in calcareous red algae and mussels collected in the Säo Sebastiäo channel State of Säo Paulo,Brazil). It is known that these neurotoxins comprise more than 25 analogues such as tetrodotoxin (TTX) and derivatives plus the paralytic shellfish toxins (PST) found in a variety of marine, freshwater and amphibious species. Filter feeding animals generally possess large amounts of these neurotoxins. The tunicates are sessil marine animals with a high rate of sea water filtration. The tunics and siphons of 50 specimens of Phallusia nigra were dissected and the visceral organs were immersed in methanol containing acetic acid 0.02 N ph 5.0. The extract was prepared by homogenization, filtration and the methanolic phase was concentrated under reduced pressure and defatted with chloroform. The polar phase was evaporated and the residue dissolved in deionized water for further purification in ionic-exchange resin column (Bio-Gel P-2) and HPLC analysis. The extract showed paralytic effects on mouse assay (26.9 MU/100mg) and on crustacean isolated nerve preparations. The chemical analysis for TTX and PST revealed toxins with retention times similar to gonyautoxins, saxitoxins and TTX. These findings are important to explain future toxin envenoming outbreaks on the Brazilian coast.

Intoxicación por picadura de alacranes del estado de Guerrero, México: investigación preliminar / Porsoning by scorplanbites fron Guerreiro, state México: preliminary research

Se revisó en forma exhaustiva la morbimortalidad causada por los alacranes ponzoñosos del estado de Guerrero, México. Del 1 de enero de 1978, al 30 de abril de 1985 se registraron 12.653 casos con 99 defunciones, en 28 localidades de Guerrero, principalmente Iguala, Zihuatanejo, Chilapa, Taxco, Chilpancingo y Acapulco. Los alacranes Centruroides limpidus limpidus, C. elegans y C. nigrescens, se encuentran distribuidos ampliamente en varios lugares de la faja tropical y de las zonas áridas de Guerrero. Se revisaron aspectos clínicos, distribución según edad y sexo, tratamientos y prevención del envenenamiento