Your browser doesn't support javascript.
loading
Mostrar: 20 | 50 | 100
Resultados 1 - 2 de 2
Filtrar
1.
Chinese Journal of Natural Medicines (English Ed.) ; (6): 677-682, 2016.
Artículo en Inglés | WPRIM | ID: wpr-812578

RESUMEN

The present study was designed to identify immunomodulatory components from the leech salivary gland of Haemadipsa sylvestris. The Sephadex G-50, Resource(TM) S column chromatography and reverse-phase high performance liquid chromatography (RP-HPLC) were used to isolate and purify the salivary gland extracts (SGE). Structural analysis of isolated compounds was based on Edman degradation and matrix assisted laser desorption ionization time-of-flight mass spectrometer (MALDI-TOF-MS). The cDNA encoding the precursor of the compound was cloned from the cDNA library of the salivary gland of H. sylvestris. The levels of inflammatory mediators, including tumor necrosis factor-α (TNF-α), interferon γ (IFN-γ), interleukin-6 (IL-6), and monocyte chemotactic protein-1 (MCP-1) were assayed using an enzyme-linked immunosorbent assay (ELISA). The effects on cell proliferation and cell viability were observed using MTT assay. A novel neuropeptide Y (Neuropeptide Y-HS) from the leech salivary gland of H. sylvestris was purified and characterized. It was composed of 36 amino acid residues and the amino acid sequence was determined to be FLEPPERPAVFTSVEQMKSYIKALNDYYLLLGRPRF-NH2, containing an amidated C-terminus. It showed significant inhibitory effects on the production of inflammatory cytokines including TNF-α, IFN-γ, IL-6, and MCP-1. Neuropeptide Y was identified from leeches for the first time. The presence of neuropeptide Y-HS in leech salivary gland may help get blood meal from hosts and inhibit inflammation.


Asunto(s)
Animales , Ratones , Secuencia de Aminoácidos , Factores Inmunológicos , Química , Genética , Inflamación , Quimioterapia , Alergia e Inmunología , Interferón gamma , Alergia e Inmunología , Interleucina-6 , Alergia e Inmunología , Sanguijuelas , Química , Espectrometría de Masas , Datos de Secuencia Molecular , Neuropéptido Y , Química , Genética , Mapeo Peptídico , Glándulas Salivales , Química , Factor de Necrosis Tumoral alfa , Alergia e Inmunología
2.
Chinese Journal of Rehabilitation Theory and Practice ; (12): 103-104, 2006.
Artículo en Chino | WPRIM | ID: wpr-973607

RESUMEN

@#ObjectiveTo investigate the effect of out-patient training combined with family training under doctor's instructions on children with cerebral palsy (CP).Methods80 CP children were selected as treatment group and trained one to three months by therapists at out-patient department, then continually trained at family by parents who received doctor's instructions 30 min once every two or three months. 60 CP children in hospital were selected as control group. Rehabilitative effects of two groups were compared.ResultsIn the first and third month after training completed, movement growth of treatment group was not different from that of control group (P>0.05), but in the sixth month, was significant different from that of control group (P<0.05). The effect of treatment group was better than that of control group.ConclusionOut-patient training combined with family training under doctor's instructions can decrease treatment expenses, and is convenient and effective for CP children.

SELECCIÓN DE REFERENCIAS
DETALLE DE LA BÚSQUEDA