Your browser doesn't support javascript.
loading
Purification and n-terminal sequencing of two presynaptic neurotoxic PLA2, neuwieditoxin-I and neuwieditoxin-II, from Bothrops neuwiedi pauloensis (jararaca pintada) venom
Borja-Oliveira, C. R; Kassab, B. H; Soares, A. M; Toyama, M. H; Giglio, J. R; Marangoni, S; Re, L; Rodrigues-Simioni, L.
  • Borja-Oliveira, C. R; State University of Campinas. School of Medical Sciences. Department of Pharmacology. Campinas. BR
  • Kassab, B. H; State University of Campinas. Institute of Biology. Department of Biochemistry. Campinas. BR
  • Soares, A. M; University of São Paulo. FCFRP. School of Pharmaceutical Sciences. Department of Clinical, Toxicological and Bromatological Analyses. Ribeirão Preto. BR
  • Toyama, M. H; State University of Campinas. Institute of Biology. Department of Biochemistry. Campinas. BR
  • Giglio, J. R; University of São Paulo. School of Medicine. Department of Biochemistry and Immunology. Ribeirão Preto. BR
  • Marangoni, S; State University of Campinas. Institute of Biology. Department of Biochemistry. Campinas. BR
  • Re, L; University of Ancona. Laboratory of Pharmacology. Institute of Experimental and Clinical Sciences. Ancona. IT
  • Rodrigues-Simioni, L; University of São Paulo. FCFRP. School of Pharmaceutical Sciences. Department of Clinical, Toxicological and Bromatological Analyses. Ribeirão Preto. BR
J. venom. anim. toxins incl. trop. dis ; 13(1): 103-121, 2007. graf, tab
Article Dans Anglais | LILACS | ID: lil-444615
ABSTRACT
Two presynaptic phospholipases A2 (PLA2), neuwieditoxin-I (NeuTX-I) and neuwieditoxin-II (NeuTX-II), were isolated from the venom of Bothrops neuwiedi pauloensis (BNP). The venom was fractionated using molecular exclusion HPLC (Protein-Pak 300SW column), followed by reverse phase HPLC (æBondapak C18 column). Tricine-SDS-PAGE in the presence or absence of dithiothreitol showed that NeuTX-I and NeuTX-II had a molecular mass of approximately 14 kDa and 28kDa, respectively. At 10æg/ml, both toxins produced complete neuromuscular blockade in indirectly stimulated chick biventer cervicis isolated preparation without inhibiting the response to acetylcholine, but NeuTX-II reduced the response to KCl by 67.0±8.0 percent (n=3; p<0.05). NeuTX-I and NeuTX-II are probably responsible for the presynaptic neurotoxicity of BNP venom in vitro. In fact, using loose patch clamp technique for mouse phrenic nerve-diaphragm preparation, NeuTX-I produced a calcium-dependent blockade of acetylcholine release and caused appearance of giant miniature end-plate potentials (mepps), indicating a pure presynaptic action. The N-terminal sequence of NeuTX-I was DLVQFGQMILKVAGRSLPKSYGAYGCYCGWGGRGK (71 percent homology with bothropstoxin-II and 54 percent homology with caudoxin) and that of NeuTX-II was SLFEFAKMILEETKRLPFPYYGAYGCYCGWGGQGQPKDAT (92 percent homology with Basp-III and 62 percent homology with crotoxin PLA2). The fact that NeuTX-I has Q-4 (Gln-4) and both toxins have F-5 (Phe-5) and Y-28 (Tyr-28) strongly suggests that NeuTX-I and NeuTX-II are Asp49 PLA2.
Sujets)
Texte intégral: Disponible Indice: LILAS (Amériques) Sujet Principal: Phospholipases A / Bothrops / Venins de crotalidé / Neurotoxines Limites du sujet: Animaux langue: Anglais Texte intégral: J. venom. anim. toxins incl. trop. dis Thème du journal: Toxicologie Année: 2007 Type: Article Pays d'affiliation: Brésil / Italie Institution/Pays d'affiliation: State University of Campinas/BR / University of Ancona/IT / University of São Paulo/BR

Documents relatifs à ce sujet

MEDLINE

...
LILACS

LIS

Texte intégral: Disponible Indice: LILAS (Amériques) Sujet Principal: Phospholipases A / Bothrops / Venins de crotalidé / Neurotoxines Limites du sujet: Animaux langue: Anglais Texte intégral: J. venom. anim. toxins incl. trop. dis Thème du journal: Toxicologie Année: 2007 Type: Article Pays d'affiliation: Brésil / Italie Institution/Pays d'affiliation: State University of Campinas/BR / University of Ancona/IT / University of São Paulo/BR