Antibacterial, Anti-Biofilm, and Anti-Inflammatory Properties of Gelatin-Chitosan-Moringa-Biopolymer-Based Wound Dressings towards Staphylococcus aureus and Escherichia coli.

In contemporary times, the sustained aspiration of bioengineering and biomedical applications is the progressive advancement of materials characterized by biocompatibility and biodegradability. The investigation of the potential applications of polymers as natural and non-hazardous materials has placed significant emphasis on their physicochemical properties. Thus, this study was designed to investigate the potential of gelatin-chitosan-moringa leaf extract (G-CH-M) as a novel biomaterial for biomedical applications. The wound-dressing G-CH-M biopolymer was synthesized and characterized. The blood haemolysis, anti-inflammatory, antioxidant, and antibacterial activities of the biopolymer were investigated against Gram-positive (Staphylococcus aureus) and Gram-negative (Escherichia coli) bacterial isolates. Our results showed that S. aureus swarming motility was drastically affected. However, the biopolymer had no significant effect on the swarming motility of E. coli. In addition, the biopolymer showed high antibacterial capacities, especially against S. aureus. Plasmid DNA was observed to be effectively protected from oxidative stresses by the biopolymer. Furthermore, the biopolymer exhibited greatly suppressed haemolysis (lower than 2%), notwithstanding the elevated concentration of 50 mg/mL. These results indicated that this novel biopolymer formulation could be further developed for wound care and contamination prevention.

Improvement of camel milk-clotting: Usefulness of crude extract from green pods of carob (Ceratonia siliqua. L) as a substitute for commercial rennet.

Camel milk transformation into cheese remains an objective to be improved today. This study aimed to improve camel milk clotting using a crude extract from green pods of carob as a substitute for commercial rennet. The composition of the crude carob extract was determined for dry matter and protein content. Milk clotting conditions were studied at different temperatures, pH and CaCl2 concentrations. Milk clotting properties were assessed by milk clotting activity, specific activity and proteolytic activity. Enzymatic hydrolysis of camel milk caseins by crude carob extract and its inhibition were demonstrated by SDS-polyacrylamide gel electrophoresis. Crude carob extract analysis showed a protein and dry matter content of 23.26±0.5 mg/ml and 30.66±0.5 g/l, respectively. Optimal milk clotting activity was observed at 53.6 °C, pH 4.5, and 0.09 M CaCl2. The crude carob extract showed a high milk clotting activity (4.97 U/ml) and a low proteolytic activity (0.04U/ml) with camel milk. The cheese yield of curd produced from camel milk using crude carob extract was the highest (23.95%) compared with that of Camel chymosin (20.5%). The high ratio of milk-clotting to proteolytic activity shows the potential of this extract as a substitute for commercial rennet in the dairy industry.

Relation between Color and Chemical Composition of Dromedary Camel Colostrum.

Camel milk industrialization faces technological problems related to the presence of colostrum in milk. The determination of color parameters may serve to differentiate between colostrum and milk. This work aimed to study the relationship between the chemical composition of camel colostrum and milk and their colors. Samples of colostrum were collected at 2, 12, 24, 48, 72, 96, 120, 144, 168, and 360 h postpartum (n = 16), and their physicochemical properties (pH, acidity, viscosity, color, dry matter, ash, protein, and fat) were analyzed. The results show that all the components decreased during the first 3 days except fat. The content of this later increased from zero in the three sampling on the first day (2, 12, and 24 h) to 1.92 ± 0.61% at 48 h postpartum. The amount of total dry matter and protein decreased from 20.95 ± 3.63% and 17.43 ± 4.28% to 13.05 ± 0.81% and 3.71 ± 0.46%, respectively, during the first 7 days postpartum. There was a weak correlation between the brightness (L*) of the camel milk and its contents of dry matter, protein, and fat; however, these parameters were strongly correlated with redness (a*) and yellowness (b*). Ash content was poorly correlated with the color parameters. Hence, the measurement of the color parameters of camel colostrum and milk can be a new tool to evaluate their quality.

Factors affecting milk yield and composition of Tunisian camels (Camelus dromedarius) over complete lactation.

This study aimed to investigate the milk production potential and the impact of nongenetic factors on milk yield and composition of Tunisian dromedary camels. Milk recording and sampling were carried out at monthly intervals over complete lactation for 3 years from 95 camels reared in intensive and semi-intensive systems. The overall means of daily milk yield and fat, protein, total solids, and ash contents were 4.21 ± 1.98 l/day, 2.45 ± 0.9%, 2.67 ± 0.74%, 10.75 ± 1.41%, and 0.85 ± 0.08%, respectively. The total milk yield was 1388.41 ± 575.46 l/lactation for 11 months of lactation. The daily milk yield increased regularly throughout lactation until it reached its peak in the 4th month postpartum and then decreased until the 17th month postpartum. The chemical components, except ash, followed an opposite trend to the milk yield. Their minimum contents were recorded during the 7th and 8th months postpartum, while the maximum levels were observed during the 17th month postpartum. Regarding seasonal variation, the highest daily milk yield was recorded during summer (June), whereas the lowest was found in winter (December). In contrast, the maximum and minimum contents of fat and protein were observed during winter (December) and summer (July), respectively. Similarly, total solids content was maximum in January and minimum in August. Parity had no effect on daily milk yield, while all chemical components were higher in milk from primiparous than multiparous camels. Calf sex and management system did not affect the milk yield and composition. These results are useful in order to develop feeding strategies and breeding programs for improving milk production.

Antilisterial activity of dromedary lactoferrin peptic hydrolysates.

The aim of this study was to explore the antibacterial peptides derived from dromedary lactoferrin (LFc). The LFc was purified from colostrum using a batch procedure with a cation exchange chromatography support and was hydrolyzed with pepsin to generate peptic digest. This peptic digest was fractionated by cation exchange chromatography, and the antilisterial activity of LFc, peptic digest, and obtained fractions was investigated using the bioscreen method. The growth of Listeria innocua ATCC 33090 and LRGIA 01 strains was not inhibited by LFc and its hydrolysates. Two fractions of dromedary lactoferrin peptic hydrolysate were active against both strains. A tandem mass spectroscopy analysis revealed that the 2 active fractions comprised at least 227 different peptides. Among these peptides, 9 found in the first fraction had at least 50% similarity with 10 known antimicrobial peptides (following sequence alignments with the antimicrobial peptide database from the University of Nebraska Medical Center, Omaha). Whereas 9 of these peptides presented homology with honeybee, frog, or amphibian peptides, the 10th peptide, F152SASCVPCVDGKEYPNLCQLCAGTGENKCACSSQEPYFGY192 (specifically found in 1 separated fraction), exibited 54% homology with a synthetic antibacterial peptide (AP00481) derived from human lactoferrin named kaliocin-1. Similarly, the second fraction contained 1 peptide similar to lactoferrampin B, an antibacterial peptide derived from bovine milk. This result suggests that peptic hydrolysis of LFc releases more active antimicrobial peptides than their protein source and thus provides an opportunity for their potential use to improve food safety by inhibiting undesirable and spoilage bacteria.

Factors affecting the milk yield and composition over lactation of prolific D'man ewes in Tunisian oases.

This work aimed to investigate milk potentiality and the influence of some non-genetic factors both on milk yield production and composition in prolific D'man sheep. Observations were performed in eighty lactating D'man ewes maintained under an intensive oases system in Southern Tunisia. Daily milk yield was determined at 7-day intervals using oxytocin + hand milking method. Chemical milk composition was determined by Lactoscan. Total productions over lactation (milk, fat, and protein) were estimated using the Fleischmann method. Daily milk yield averaged 1.64 ± 0.02 l. It increased to a plateau from the third to the fourth week of lactation, and decreased gradually to the tenth week. D'man ewes produced 128.91 ± 3.14 l of milk, 9.23 ± 0.26 kg of fat, and 5.26 ± 0.12 kg of total proteins. Overall, milk contained 16.17% of total solids, 7.08% of fat, 4.04% of proteins, 4.32% of lactose, 9.09% of solids-not-fat, and 0.73% of ash. Lambing season affected the daily milk yield and milk composition, where fat and total proteins were highest in autumn. Total solids, lactose, solids-not-fat, and ash were higher in winter than in autumn and summer. Ewes reared multiple lambs produced more milk than those reared singles. Dams nursing triplets or more had the highest milk total proteins, and the lowest total solids and fat levels. Adult ewes produced more milk compared to younger and older ewes, and their milk contained higher total solids, fat, and ash levels than milk from young ewes. Ewes with asymmetric udder produced less and more concentrated milk than ewes with symmetrical udder. Daily milk yield was negatively correlated to total solids, fat, and total proteins amounts. In contrast, litter survival at weaning was positively correlated to the amounts of total milk, fat, and total proteins.