Effect of sequence length, sequence frequency, and data acquisition rate on the performance of a Hadamard transform time-of-flight mass spectrometer.

Various factors influencing the performance of a Hadamard transform time-of-flight mass spectrometer (HT-TOFMS) have been investigated. Using a nitrogen corona discharge to produce an ion stream of N2+, N3+, and N4+, it is found for spectra containing only N4+ that the signal-to-noise ratio (SNR) closely approaches the value calculated from the ion background by assuming that the ion background follows a Poisson distribution. In contrast, for a more intense beam containing N2+, N3+, and N4+, the SNR is less than its theoretical value because of the appearance of discrete spikes in the mass spectrum caused by deviations in the actual modulation sequence from the ideal one. These spikes can be reduced, however, by decreasing the modulation voltage. Under these optimized conditions, the pseudo-random sequence length is varied to understand how it alters SNR, mass resolution, and scan speed. When the length of the pseudo-random sequence is doubled, the SNR increases by the square root of 2 while the time necessary to record a mass spectrum also doubles. Mass resolution can be varied between 500 and 1200 at m/z = 609 as the sequence length, modulation speed (10 MHz, 25 MHz), and acquisition rate (up to 50 MHz) are changed. Scan speeds of 6000 passes per s can be obtained using a sequence containing 4095 elements modulated at 25 MHz. The capability to tailor the HT-TOFMS to increase the scan speed and resolution with a constant 50% duty cycle makes the technique extremely appealing as a mass analyzer for measuring rapid changes in the composition of an ion stream.

An immunochemical study of avian pancreatic polypeptide: the nature of the principal epitope.

Structural features contributing to the antigenic recognition of the small globular hormone avian pancreatic polypeptide (APP) by a polyclonal antiserum have been defined using a solution phase radioimmunoassay technique. Cross-reactivity studies with PP homologues suggest that the surface residues within the alpha-helix of the peptide may be antigenic, whereas hydrophilicity and atomic mobility predictive methods implicate the molecules beta-turn region. Immunochemical data and circular dichroism measurements on a timed trypsin digest of APP indicate that the secondary structure of the alpha-helix is vital for the molecule's immunological competence. Immunoreactivities of iodinated derivatives of APP, as well as that of peptide fragments of APP and its homologues, support the importance of teritary structure involving the interaction of the polyproline and alpha helices. The highly mobile C-terminal residues 34-36 (His-Arg-Tyr-NH2) have been found by immunological analysis to be unimportant. Arginine residue 33, which has been conserved through vertebrate evolution, is a major antigenic contributor, since a large decrease in immunoreactivity, not accompanied by a significant change in conformation, was observed upon specific removal of this residue by carboxypeptidase B. These results are consistent with a "discontinuous" epitopic model for APP in which Arg-33 and exposed residues in the alpha-helix are principal components of an epitope or epitopes mediated by the secondary and tertiary structures of the molecule.

TRH-like immunoreactivity in endocrine cells and neurons in the gastro-intestinal tract of the rat and guinea pig.

By use of the indirect immunofluorescence technique, the cellular localization of thyrotropin-releasing hormone (TRH) was studied in the gastrointestinal tract of rats and guinea pigs of different ages. TRH-like immunoreactivity (LI) was observed in many pancreatic islet cells of young rats and guinea pigs but only in single cells of 6-month-old rats. In aged guinea pigs, a reduction in the number of TRH-positive cells was evident; however, numerous strongly fluorescent cells were still present. In the guinea pig, TRH-LI was in addition observed in gastrin cells in the stomach. TRH-positive nerve fibers occurred in the myenteric plexus of the oesophagus, stomach and intestine of the rat, and in the muscle layers of the guinea pig. These results suggest a functional role of TRH both as hormone and neuroactive compound in various portions and sites of the gastro-intestinal tract of the rat and guinea pig.

Isolation of alligator gar (Lepisosteus spatula) glucagon, oxyntomodulin, and glucagon-like peptide: amino acid sequences of oxyntomodulin and glucagon-like peptide.

Oxyntomodulin, glucagon, and a glucagon-like peptide (GLP) have been isolated from the endocrine pancreas of the alligator gar (Lepisosteus spatula), a ganoid fish. The three peptides were isolated by gel filtration and HPLC and were identified by size, composition, and glucagon-like immunoreactivity. The amino acid sequences of the oxyntomodulin and GLP were determined. The oxyntomodulin contains 36 amino acid residues and its sequence is H S Q G T F T N D Y S K Y L D T R R A Q D F V Q W L M S T K R S G G I T. The composition of the glucagon is identical to the N-terminal 29 residues of the gar oxyntomodulin. The single form of GLP found contains 34 amino acid residues in the following sequence: H A D G T Y T S D V S S Y L Q D Q A A K K F V T W L K Q G Q D R R E. These findings suggest that all three peptides are derived from a common precursor.

Influence of avian pancreatic polypeptide on pancreatic and biliary secretion in laying hens.

White Leghorn hens, 14 to 29 wk of age, were surgically prepared with cannulae for collecting secretions from the cystic duct and the duct draining the ventral pancreatic lobe and for infusing the jugular vein with avian pancreatic polypeptide (aPP) or saline. A plasma infusion rate that produced a plasma level of 15 ng of aPP/mL was used. A comparison of values obtained during saline infusion with those obtained during aPP infusion indicated that pancreatic and biliary secretory volumes and pancreatic total protein concentration were significantly depressed by aPP. The pH of pancreatic and biliary secretions were not significantly affected by aPP. Because aPP also depresses gastric secretion and motility in hens, it is proposed that its physiological role may be to oppose or modulate the actions of other, stimulatory gastrointestinal hormones.

Endocrine pancreas in the rat model of exocrine pancreatic insufficiency.

A new technique to obstruct the pancreatic ducts was developed by injecting zein solution into the common bile duct of the rat. Four weeks after the injection, the fate of the endocrine pancreas was investigated by studying (a) pancreatic content of four pancreatic hormones, (b) histology and immunohistochemistry of the pancreas, (c) i.v. glucose tolerance and i.v. insulin tolerance tests for monitoring plasma glucose, insulin, and pancreatic polypeptide (PP) levels in vivo, and (d) in vitro perifusion of pancreatic tissue slices to assess insulin and PP secretion. In zein-injected rats, the total pancreatic content of insulin, glucagon, PP, and somatostatin was reduced to 80, 70, 40, and 20%, respectively, of the corresponding controls. In response to insulin-induced hypoglycemia, the plasma PP levels rose to about one-half that of the controls. By contrast, perifused zein-injected rat pancreases released several times more PP than the controls in response to carbachol stimulation. In zein-injected rats, total pancreatic protein was reduced to 20% of the controls and pancreatic amylase was almost absent, reflecting practically complete loss of acinar tissue. Thus, this experimental model appears to be suitable for producing chronic pancreatic insufficiency in the rat and provides a useful model for studying both endocrine and exocrine functions in the small rodent.

Iodinated derivatives of the hormone avian pancreatic polypeptide.

Reaction of avian pancreatic polypeptide with an iodine monochloride reagent at both pH 4 and pH 7.5 results in the differential modification of the four tyrosine residues in this peptide hormone. A total of 19 distinct iodinated derivatives were isolated by reverse-phase high-performance liquid chromatography, and their sites of iodination were characterized by both tryptic mapping and leucine aminopeptidase techniques coupled with HPLC. The pH 4 reaction produced 16 derivatives which, overall, represented substantial iodination at each tyrosine residue, whereas the pH 7.5 reaction was more directed, producing only 7 derivatives. Iodination at the C-terminal tyrosineamide 36 predominated at both pH values, and diiodo-Tyr 36 was found in the majority of the pH 7.5 derivatives. The relative of the four tyrosine residues with ICl were as follows: at pH 7.5, Tyr 36 much greater than Tyr 21 much greater than Tyr 27 greater than Tyr 7; at pH 4, Tyr 36 greater than Tyr 27 greater than Tyr 7 greater than Tyr 21.

Isolation and structures of alligator gar (Lepisosteus spatula) insulin and pancreatic polypeptide.

Insulin and a 36-residue peptide with homology to pancreatic polypeptide (PP) were isolated from the endocrine pancreas of the alligator gar (Lepisosteus spatula), a ganoid fish, by gel filtration and HPLC. Heterologous radioimmunoassays were used to detect insulin-like and PP-like immunoreactivities during purification of the two peptides. The sequence of the 36-amino acid peptide containing a C-terminal tyrosinamide was identical at 31 of 36 positions to porcine neuropeptide Y (NPY). The amino acid sequence of this peptide is YPPKPENPGEDAPPEELAKYYSALRHYINLITRQRY-NH2. The second peptide, gar insulin, contains 52 amino acid residues and is composed of a 21-residue A chain and a 31-residue B chain. The sequence of the A chain is GIVEQCCHKPCTIYELENYCN. The sequence of the B chain is AANQHLCGSHLVEALYLVCGEKGFFYNPNKV.

Structure of a peptide from coho salmon endocrine pancreas with homology to neuropeptide Y.

The amino acid sequence of a peptide isolated from the Pacific salmon (Oncorhynchus kisutch) endocrine pancreas has been determined. This simple 36 residue peptide is a member of the pancreatic polypeptide family. It contains a C-terminal tyrosinamide and is more homologous with porcine neuropeptide Y (NPY) (83%) and peptide YY (75%) than any of the previously characterized pancreatic polypeptides (PP). This peptide appears to be the major but not the only representative of this family of peptides present in the endocrine pancreas of this fish. This peptide is referred to as salmon pancreatic polypeptide (salmon PP).

Pancreatic hormones in streptozotocin-diabetic rats.

Pancreatic polypeptide (PP) levels of plasma and pancreas were studied in the rat after streptozotocin (STZ) injection. In 4 weeks of observation, plasma PP was elevated up to 4 times the control values with marked hyperglycemia and insulinopenia. At 4 weeks, intravenous (i.v.) glucose tolerance tests and i.v. insulin tolerance tests were performed. In the glucose tolerance test, control rats responded with a 10-fold increase in plasma insulin and 15% decrease in plasma PP levels, whereas STZ-diabetic rats produced no increase of plasma insulin and an approximately 50% reduction of plasma PP levels with marked hyperglycemia. In the insulin tolerance test, diabetic rats showed a marked increase in plasma PP levels and less increase in plasma insulin levels than the controls. In diabetic rats, pancreatic insulin levels were reduced to about 3.5% of control, whereas those of somatostatin (SRIF), PP and glucagon were elevated to 8.3, 2.7 and 1.4 times control, respectively. In a morphometric study, islet areas of diabetic rats were seen to be reduced to about 10% of control. With in vitro perfused pancreatic slices, STZ-diabetic pancreas released much more glucagon and PP than control pancreas. Thus, STZ injection in the rat caused marked beta-cell damage as well as hyperplasia of SRIF, PP and glucagon cells, with glucagon and PP hypersecretion.

Characterization of coho salmon (Oncorhynchus kisutch) islet somatostatins.

Three different somatostatins have been isolated from the pancreatic islet tissue of the coho salmon (Oncorhynchus kisutch) by gel filtration and HPLC. Two of these peptides contain 14 amino acids and the larger third peptide consists of 25 amino acids. The sequence of the salmon SST-25 is Ser-Val-Asp-Asn-Leu-Pro-Pro-Arg-Glu-Arg-Lys-Ala-Gly -Cys-Lys-Asn-Phe-Tyr-Trp-Lys-Gly-Phe-Thr-Ser-Cys. The sequence of the salmon SST-14-I is Ala-Gly-Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys. The other small somatostatin (SST-14-II) which was not sequenced has an amino acid composition identical to the C-terminal 14 amino acids of the SST-25 and it is probably derived from this larger form. Evidence for low levels of a somatostatin containing 28 amino acids is also presented. This SST-28 appears to be an N-terminal extended precursor of SST-25 or a peptide derived via alternative processing of a common preprosomatostatin. Injected into juvenile salmon, SST-25 caused a decline in circulating levels of plasma insulin, depletion of liver glycogen, and activation of lipolytic pathways. Juvenile salmon treated with anti-SST-25 serum revealed elevated levels of plasma insulin as well as an increase of the glycogen content of the liver.

Isolation and structures of coho salmon (Oncorhynchus kisutch) glucagon and glucagon-like peptide.

Glucagon and glucagon-like peptide (GLP) containing 31 amino acids have been isolated from the principal islet of coho salmon (Oncorhynchus kisutch) by gel filtration of acid alcohol extracts followed by HPLC, and the complete amino acid sequence of both peptides has been determined. Salmon glucagon is a simple 29 residue peptide differing at 3 positions when compared to catfish glucagon and at 8 positions when compared to porcine glucagon. Salmon GLP differs at 6 positions when compared with the N-terminal 31 amino acids of the 34 amino acid catfish GLP. Both coho salmon glucagon and GLP cross-react weakly in our mammalian glucagon radioimmunoassay and therefore this technique could not be used to determine tissue content. Glucagon and GLP isolated amounted to 156 micrograms/g and 350 micrograms/g wet tissue, respectively.

Influence of cholecystokinin, vasoactive intestinal peptide and secretin on plasma concentration of avian pancreatic polypeptide in laying hens.

The influence of saline infusion (i.v.) followed by infusion of either cholecystokinin, vasoactive intestinal peptide, or secretin on plasma concentration of avian pancreatic polypeptide (aPP) was studied in sixteen 18-26-week old Single Comb White Leghorn hens. Three concentrations were used for each hormone. Blood was drawn after both saline and hormone infusions and assayed for aPP content. No significant influence of any of the three hormones on plasma aPP level was found in either fed or fasted hens.

Pancreatic polypeptide-secreting islet cell tumor. A follow-up report.

A case of documented pancreatic polypeptide (PP)-secreting islet cell tumor was followed for 3 years and 8 months until death due to multiple metastases. The patient initially presented with extremely high serum PP levels without clinical symptoms. After resection of the PP-secreting islet cell tumor, serum PP levels gradually decreased to normal levels. Serum PP levels started to elevate 10 months after the surgery, when liver metastases were verified by open biopsy. The patient was treated with streptozotocin (STZ), and normal serum PP levels returned. However, multiple liver and bone metastases were detected 32 months after resection of the tumor, which led to death. The recurrent tumor obtained at autopsy contained very little immunoreactive PP. The effect of STZ on PP secretion by the islet cell tumor is discussed.

Coexistence of pancreatic polypeptide and substance P in the chicken retina.

The present immunohistochemical study using flat-mounted and frozen sections has revealed that in the chicken retina, pancreatic polypeptide (PP)-, such as avian pancreatic polypeptide (APP) and neuropeptide Y (NPY), and substance P (SP)-like immunoreactive (PPI and SPI) amacrine cells are composed of more heterogeneous subpopulations than has hitherto been supposed. Furthermore, using double-staining immunohistochemical procedures, we demonstrate that a substantial proportion of some subtypes of PPI cells contain SPI and that the ratio of both PPI and SPI cells to total immunoreactive cells differs according to the retinal portions and cell types.

Pancreatic polypeptide in islet cell tumors. Morphologic and functional correlations.

Twelve islet cell tumors and one islet cell hyperplasia were studied with immunocytochemical and radioimmunoassay methods. With immunocytochemical staining, all six insulinomas, one mixed insulinoma-glucagonoma, and four gastrinomas were positive for insulin, insulin and glucagon, and gastrin, respectively. Pancreatic polypeptide (PP) was positive in three insulinomas and one mixed insulinoma-glucagonoma. All of the tumors were positive for neuron-specific enolase (NSE). Radioimmunoassays of tissue extracts further disclosed that all functioning tumors contained more than one pancreatic hormone. PP concentrations of two insulinomas and one mixed insulinoma-glucagonoma were higher than that of normal control pancreases. A study of protein meal-stimulated PP secretion revealed that three of the insulinoma cases and two gastrinoma cases exhibited higher plasma PP levels than the age-matched controls. The findings suggest that: both functioning and nonfunctioning islet cell tumors derive from neuroendocrine cells positive for NSE; all functioning islet cell tumors appear to contain PP in the tumor tissue as a minor component; as many as 70% of the patients with islet cell tumors present with abnormally higher plasma PP levels after protein meals; and a study of meal-stimulated PP secretion may well be used as a marker for the presence of functional islet cell tumors.

Pancreatic polypeptide in cystic fibrosis.

Patients with cystic fibrosis (CF) and their normal siblings and parents were studied for protein meal-stimulated pancreatic polypeptide (PP) secretion. Patients with CF who had exocrine pancreatic insufficiency did not respond to a protein meal, whereas patients with CF and normal pancreatic function presented relatively well-preserved basal and elevated postmeal PP levels. The siblings responded with relatively lower PP levels compared with the control subjects. Plasma insulin levels were also investigated, and showed sluggish initial-phase but relatively well-preserved insulin responses in the patients with CF. Immunocytochemical and morphometric studies were made of pancreata obtained at autopsy from patients with CF. In the patients younger than 7 years of age, well-preserved islet tissue was disclosed by islet-area morphometry with normal and/or below-normal PP cell counts, whereas patients older than 9 years had relatively less insulin-containing islet tissue and scanty PP cells. Absent PP secretory response in patients with CF who had exocrine pancreatic insufficiency may suggest defects in the PP secretory mechanism. Abnormal PP secretion may be used as an indirect index of pancreatic damage in CF.

Characterization of coho salmon (Oncorhynchus kisutch) insulin.

Insulin has been isolated from islet tissue of coho salmon (Oncorhynchus kisutch) by gel filtration and HPLC and the complete amino acid sequence has been determined. The sequence differs from bovine insulin at 14 sites but all interchanges are conservative from the viewpoint of preservation of conformation. A comparison of insulin sequences from other fish is presented. Salmon insulin cross-reacts very weakly with antiserum to bovine insulin and vice versa. A completely homologous radioimmunoassay has been developed and used to estimate the insulin in salmon islet tissue and in plasma. The hypoglycemic effect of salmon insulin in salmon was more pronounced and persisted longer than that caused by identical doses of bovine insulin.

The influence of avian pancreatic polypeptide on gastric secretion and motility in laying hens.

The effects of pancreatic polypeptide (PP) on digestive functions have been studied extensively in mammals. The only two previous studies on the effects of PP on avian (aPP) gastrointestinal function employed bolus injections (i.v.) of the hormone, which may have resulted in nonphysiological plasma levels of aPP. The present study was to determine the effect of aPP infused (iv) at levels simulating postprandial plasma concentrations. Young laying hens were prepared with chronic proventricular and jugular cannulas and with strain gauge transducers sutured to the serosa of the gizzard. In each experiment, a control saline infusion was followed by infusion sufficient to achieve either 7.5 or 15 ng aPP/ml of plasma. Volume, pH, and pepsin content of gastric secretions and frequency and amplitude of gastric contractions were determined. At 15 ng aPP/ml of plasma, secretory volume (P less than .01) and contractile frequency (P less than .001) were significantly depressed as compared to similar data during the saline infusion. At 7.5 ng aPP/ml of plasma, only contractile frequency (P less than .01) was depressed.

Distribution of six neuropeptides in the nucleus tractus solitarii of the rat: an immunohistochemical analysis.

Distribution of substance P-, [Leu]enkephalin-, cholecystokinin-8-, neurotensin-, avian pancreatic polypeptide- and gamma-melanocyte stimulating hormone-like immunoreactive structures were investigated in the nucleus tractus solitarii of the rat by means of the indirect immunofluorescence method. The density of the immunoreactive structures varied markedly according to neuropeptides or subnuclei, with the medial and commissural nuclei containing the highest density. This suggests that the peptides examined play a role in cardiovascular function. However, as seen in the substance P- and [Leu]enkephalin-like immunoreactive structures, these peptides were widely distributed in the nucleus tractus solitarii in addition to the commissural and medial nuclei; a high density of immunoreactive fibers in the ventral, dorsolateral and intermediate subnuclei. In addition to the immunoreactive fiber plexus, a group of immunoreactive cells was also identified in the subnuclei mentioned above. These findings strongly suggest that substance P- and [Leu]enkephalin-like immunoreactive structures are involved not only in cardiovascular function but also in other functions such as respiration, at least in the rat. Finally, the present study demonstrated that the area postrema, particularly its lateral portion, contains various neuropeptide-like structures, both neurons and fibers, substance P-, [Leu]enkephalin-, cholecystokinin-8- and neurotensin-like immunoreactive neurons and fibers, and avian pancreatic polypeptide- and gamma-melanocyte stimulating hormone-like immunoreactive fibers.