ABSTRACT
Seven novel macrocyclic polypeptides, designated as varv peptides B-H, have been isolated from the aerial parts of Viola arvensis. Their primary structures have been elucidated by automated Edman degradation and mass spectrometry. They all consist of 29 or 30 amino acid residues, covalently cyclized via the amide backbone and by three internal disulfide bridges. Their amino acid sequences are as follows: varv peptide B, cyclo-(TCFGGTCNTPGCSCDPWPMCSRNGLPVCGE); varv peptide C, cyclo-(TCVGGTCNTPGCSCSWPVCTRNGVPICGE); varv peptide D, cyclo-(TCVGGSCNTPGCSCSWPVCTRNGLPICGE); varv peptide E, cyclo-(TCVGGTCNTPGCSCSWPVCTRNGLPICGE); varv peptide F, cyclo-(TCTLGTCYTAGCSCSWPVCTRNGVPICGE); varv peptide G, cyclo-(TCFGGTCNTPGCSCDPWPVCSRNGVPVCGE); and varv peptide H, cyclo-(TCFGGTCNTPGCSCETWPVCSRNGLPVCGE). The varv peptides B-H exhibited high degrees of homology with the hitherto known macrocyclic peptides varv peptide A, kalata B1, violapeptide I, circulins A and B, and cyclopsychotride A.
Subject(s)
Peptides, Cyclic/isolation & purification , Plants/chemistry , Amino Acid Sequence , Molecular Sequence Data , Peptides, Cyclic/chemistry , Peptides, Cyclic/genetics , Phylogeny , Protein Conformation , Spectrometry, Mass, Matrix-Assisted Laser Desorption-IonizationABSTRACT
A fractionation protocol for the isolation of a highly purified polypeptide fraction from plant biomass is described. The procedure dereplicates ubiquitous substance classes known to interfere with bioassays often used in natural product-based drug discovery programs. The protocol involves pre-extraction with dichloromethane, extraction with ethanol (50%), removal of tannins with polyamide, removal of low-molecular-weight components with size-exclusion chromatography over Sephadex G-10, and final removal of salts and polysaccharides with solid-phase extraction using reversed-phase cartridges. The method has been applied to the aerial parts of Viola arvensis, resulting in the isolation of a peptide fraction that on further separation yielded a novel 29-residue macrocyclic polypeptide named varv peptide A, cyclo(-TCVGGTCNTPGCSCSWPVCTRNGLPVCGE-).
ABSTRACT
The involvement of the glucoalkaloid strictosidine in antimicrobial and antifeedant activity inCatharanthus roseus leaves was investigated. Strictosidine and its deglucosylation product, specifically formed by the enzyme strictosidine glucosidase, were shown to be active against several microorganisms. In contrast, neither the intact glucoside, nor the aglycone product(s) was found to exhibit antifeedant activity againstSpodoptera exigua larvae, as was found for intactC. roseus leaves and leaf extracts. Besides alkaloids further downstream in the biosynthesis pathway, a more apolar, yet unidentified compound may be involved in this activity.
