Laser spectroscopy of the [Formula: see text], [Formula: see text] transitions in stored and cooled relativistic C[Formula: see text] ions.

The [Formula: see text] and [Formula: see text] transitions in Li-like carbon ions stored and cooled at a velocity of [Formula: see text] in the experimental storage ring (ESR) at the GSI Helmholtz Centre in Darmstadt have been investigated in a laser spectroscopy experiment. Resonance wavelengths were obtained using a new continuous-wave UV laser system and a novel extreme UV (XUV) detection system to detect forward emitted fluorescence photons. The results obtained for the two transitions are compared to existing experimental and theoretical data. A discrepancy found in an earlier laser spectroscopy measurement at the ESR with results from plasma spectroscopy and interferometry has been resolved and agreement between experiment and theory is confirmed.

Time-resolved coherent Raman spectroscopy by high-speed pump-probe delay scanning.

Using a spinning window pump-probe delay scanner, we demonstrate a means of acquiring time-resolved vibrational spectra at rates up to 700 Hz. The time-dependent phase shift accumulated by the probe pulse in the presence of a coherently vibrating sample gives rise to a Raman-induced frequency shifting readily detectable in a balanced detector. This rapid delay scanning system represents a 23-fold increase in averaging speed and is >10× faster than state-of-the-art voice coil delay lines. These advancements make pump-probe spectroscopy a more practical means of imaging complex media.

Electron- and proton-impact excitation of hydrogenlike uranium in relativistic collisions.

The K shell excitation of H-like uranium (U(91+)) in relativistic collisions with different gaseous targets has been studied at the experimental storage ring at GSI Darmstadt. By performing measurements with different targets as well as with different collision energies, we were able to observe for the first time the effect of electron-impact excitation (EIE) process in the heaviest hydrogenlike ion. The large fine-structure splitting in H-like uranium allowed us to unambiguously resolve excitation into different L shell levels. State-of-the-art calculations performed within the relativistic framework which include excitation mechanisms due to both protons (nucleus) and electrons are in good agreement with the experimental findings. Moreover, our experimental data clearly demonstrate the importance of including the generalized Breit interaction in the treatment of the EIE process.

Polarization transfer of bremsstrahlung arising from spin-polarized electrons.

We report on a study of the polarization transfer between transversely polarized incident electrons and the emitted x rays for electron-atom bremsstrahlung. By means of Compton polarimetry we performed for the first time an energy-differential measurement of the complete properties of bremsstrahlung emission related to linear polarization, i.e., the degree of linear polarization as well as the orientation of the polarization axis. For the high-energy end of the bremsstrahlung continuum the experimental results for both observables show a high sensitivity on the initial electron spin polarization and prove that the polarization orientation is virtually independent of the photon energy.

Spectral shape of the two-photon decay of the 2 1S0 state in he-like tin.

The spectral distribution of the 1s2s {1}S{0}-->1s{2} 1S0 two-photon decay of He-like tin was measured using a novel approach at the gas-jet target of the ESR storage ring. Relativistic collisions of Li-like projectiles with low-density gaseous matter have been exploited to selectively populate the desired 1s2s state. Compared to conventional techniques, this approach results in a substantial gain in statistical and systematic accuracy, which allowed us to achieve for the first time a sensitivity to relativistic effects on the two-photon decay spectral shape as well as to discriminate the measured spectrum for Sn from theoretical shapes for different elements along the He-isoelectronic sequence.

Direct determination of the magnetic quadrupole contribution to the Lyman-α1 transition in a hydrogenlike ion.

We report the observation of an interference between the electric dipole (E1) and the magnetic quadrupole (M2) amplitudes for the linear polarization of the Ly-α1 (2p3/2→1s1/2) radiation of hydrogenlike uranium. This multipole mixing arises from the coupling of the ion to different multipole components of the radiation field. Our observation indicates a significant depolarization of the Ly-α1 radiation due to the E1-M2 amplitude mixing. It proves that a combined measurement of the linear polarization and of the angular distribution enables a very precise determination of the ratio of the E1 and the M2 transition amplitudes and the corresponding transition rates without any assumptions concerning the population mechanism for the 2p3/2 state.

The MAXEBIS at GSI as a test ion source for charge breeding and for HITRAP.

The electron beam ion source MAXEBIS, developed and built at the University of Frankfurt, has been installed at GSI to serve as an offline test ion source for the HITRAP project and for use as a test setup for charge breeding explorations. The setup has been equipped with new diagnostics and beam optics devices. Two ion sources dedicated to the production of singly charged ions for external ion injection into the MAXEBIS have been included. First time of flight (TOF) spectra with external injected, charge-bred argon ions were taken. However, these spectra indicated beam losses in the beam transport from the multipassage spectrometer (MPS) to the MAXEBIS. In order to understand the losses, the beam transport has been simulated with the SIMION code and the beam line has been modified accordingly. Measurements of the MAXEBIS' beam emittance, using the "nondestructive" beam profile method, have been performed as well as measurements of the electron current density via charge state analysis of the TOF spectra. The injection and breeding efficiency of the MAXEBIS have been determined for the first time. The results of the measurements and the planned experiments will be discussed.

Emissions of PCDD/F from uncontrolled, domestic waste burning.

Emissions of polychlorinated dibenzodioxin and dibenzofuran (PCDD/F) result from inefficiencies of combustion processes, most typically waste combustion. Uncontrolled combustion, such as occurs during so-called "backyard burning" of domestic waste, may therefore produce optimal conditions for formation and emission of PCDD/F. However, few assessments of PCDD/F emissions are available from these sources. This work describes the first known comprehensive assessment of PCDD/F emissions from uncontrolled, domestic waste burning. Emissions were copious, but highly variable, ranging over several orders of magnitude. The potential for emissions appears to be related primarily to combustion parameters and concentrations of various gas-phase species, the latter which may be affected by changes in waste composition, waste orientation, and/or combustion conditions.

The simian virus 40 core origin contains two separate sequence modules that support T-antigen double-hexamer assembly.

Using subfragments of the simian virus 40 (SV40) core origin, we demonstrate that two alternative modules exist for the assembly of T-antigen (T-ag) double hexamers. Pentanucleotides 1 and 3 and the early palindrome (EP) constitute one assembly unit, while pentanucleotides 2 and 4 and the AT-rich region constitute a second, relatively weak, assembly unit. Related studies indicate that on the unit made up of pentanucleotide 1 and 3 and the EP assembly unit, the first hexamer forms on pentanucleotide 1 and that owing to additional protein-DNA and protein-protein interactions, the second hexamer is able to form on pentanucleotide 3. Oligomerization on the unit made up of pentanucleotide 2 and 4 and the AT-rich region is initiated by assembly of a hexamer on pentanucleotide 4; subsequent formation of the second hexamer takes place on pentanucleotide 2. Given that oligomerization on the SV40 origin is limited to double-hexamer formation, it is likely that only a single module is used for the initial assembly of T-ag double hexamers. Finally, we discuss the evidence that nucleotide hydrolysis is required for the remodeling events that result in the utilization of the second assembly unit.

Phosphorylation of simian virus 40 T antigen on Thr 124 selectively promotes double-hexamer formation on subfragments of the viral core origin.

Cell cycle-dependent phosphorylation of simian virus 40 (SV40) large tumor antigen (T-ag) on threonine 124 is essential for the initiation of viral DNA replication. A T-ag molecule containing a Thr-->Ala substitution at this position (T124A) was previously shown to bind to the SV40 core origin but to be defective in DNA unwinding and initiation of DNA replication. However, exactly what step in the initiation process is defective as a result of the T124A mutation has not been established. Therefore, to better understand the control of SV40 replication, we have reinvestigated the assembly of T124A molecules on the SV40 origin. Herein it is demonstrated that hexamer formation is unaffected by the phosphorylation state of Thr 124. In contrast, T124A molecules are defective in double-hexamer assembly on subfragments of the core origin containing single assembly units. We also report that T124A molecules are inhibitors of T-ag double hexamer formation. These and related studies indicate that phosphorylation of T-ag on Thr 124 is a necessary step for completing the assembly of functional double hexamers on the SV40 origin. The implications of these studies for the cell cycle control of SV40 DNA replication are discussed.

Current risk assessment approaches in different countries.

Polychlorinated dibenzo-p-dioxins (PCDDs), dibenzofurans (PCDFs) and biphenyls (PCBs) exist as complex mixtures in environmental and biological samples. There is sufficient evidence that the toxic congeners share a common mode of action, involving binding to the Ah-receptor. Toxic equivalency factors (TEFs) and chemical residue data are used to calculate toxic equivalent (TEQ) concentrations in environmental samples, foods, animal and human tissues. Two different approaches have been used in the risk assessments of PCDDs, PCDFs and dioxin-like PCBs. WHO and most countries outside the USA have derived Tolerable Daily (or weekly) Intakes (TDI) in the order of 1-10 pg per kg of body weight for TCDD or TEQs based on data from rodent carcinogenicity studies. These countries have assumed the existence of a threshold dose for the carcinogenicity of dioxins, while US EPA and USFDA have used probabilistic estimates of cancer potency, treating cancer as a non-threshold effect and using a descriptor that addresses upper bound risk, the Risk Specific Dose (RsD). In the USA and other countries there is a growing concern over the non-cancer effects of dioxin-like compounds. In general, the various risk assessments have identified groups of the population that are at particular high risks and all have stressed the urgent need to reduce the sources of the environmental contamination with these compounds to the lowest possible.

Multiplex PCR detection of Campylobacter jejuni and Arcobacter butzleri in food products.

Arcobacter is a recently described species, previously considered part of the Campylobacter family. A sensitive assay such as that provided by PCR could help to distinguish the closely related Arcobacter from Campylobacter. A PCR method to specifically detect both Campylobacter jejuni and Arcobacter butzleri in the same reaction tube has been developed. C. jejuni and A. butzleri were inoculated into a range of dairy products, raw and ready-to-eat foods. The presence of these two organisms was detected in these test foods by the multiplex PCR assay. A product of 159 bp was apparent when C. jejuni was present, while a 1223 bp product was seen when A. butzleri was present. When both organisms were present, both bands could be detected on the agarose gel. All organisms were confirmed by standard microbiological methods. There was complete agreement between the PCR and standard methods. This PCR assay will allow detection of both organisms within the same PCR tube and can be performed within an 8 h day. The presence of these two human pathogens, which are difficult to distinguish by standard biochemical methods, can now be identified using this PCR assay.

Characterization by molecular cloning and sequencing of the gene encoding an aminopeptidase from Listeria monocytogenes.

The pepC gene of Listeria monocytogenes encodes aminopeptidase C that is predicted to share 72% amino acid sequence similarity and 53% sequence identity with the cysteine aminopeptidase PepC from Lactococcus lactis. The gene product also shows strong similarity to aminopeptidase C from Streptococcus thermophilus and Lactobacillus helveticus, and to a cysteine proteinase/bleomycin hydrolase from Saccharomyces cerevisiae. The enzyme from L. monocytogenes displayed broad N-terminal hydrolytic activity, with a similar substrate specificity to its lactic acid bacterial counterpart. The inhibition spectrum shows a great deal of similarity with enzymes from the family of lactic acid bacteria. In addition, one of the clones studied contained DNA sequences that could encode a regulatory protein of the deoR helix-turn-helix DNA binding protein family. The organization of the locus, designated pep, is presented along with the characterization of the gene products of the pep locus.

Valine transport and biodiversity of Leuconostoc wild strains from French raw milk cheeses.

The rate of L-valine transport in whole cells of Leuconostoc was at the maximum at 30 degrees C, pH 6.0 in the presence of an energy source. Transport was inhibited by 40-55%, in the presence of the ionophores (valinomycin, nigericin or monensin), and uncouplers (carbonyl cyanide-m-chloro-phenylhydrazone or 2,4-dinitrophenol) confirming the previously described delta p-driven branched-chain amino acid transport system described in cytoplasmic membranes (Winters et al., 1991, Appl. Environ. Microbiol., 57, 3350-3354). Sulfhydryl group reagents (p-chloro-mercuribenzoate, iodoacetate and N-ethyl maleimide) all inhibited valine transport by 60-70%, indicating that valine is actively transported at high valine concentration. Three kinetically distinguishable transport systems were identified for each strain using whole cells, confirming results obtained with membranes. L-valine transport Kt and Vmax could be an additional tool to estimate the biodiversity of 18 Leuconostoc strains belonging to the dominant flora of French raw milk cheeses. Kt values varied from 20 to 510 nmol/l for the very high affinity system, from 26 to 427 pmol/l for the high affinity system and from 0.65 to 4.40 mmol/l for the low affinity system. No correlation existed between valine transport rates and a particular strain's ability to acidify milk or complex media, suggesting that valine transport is not a growth-limiting function in species of the genus Leuconostoc.

Rapid detection of Listeria monocytogenes by a PCR assay specific for an aminopeptidase.

Specific and rapid detection of Listeria monocytogenes is very important with regard to food safety since all other species of Listeria appear to be non-pathogenic to humans. Conventional microbiological detection methods are very time consuming. The polymerase chain reaction (PCR) is one of the most promising techniques for rapid detection of micro-organisms in food products. We have developed a PCR assay, specific for L. monocytogenes, based on the gene encoding an aminopeptidase, which previously has not been described for this species. The L. monocytogenes aminopeptidase shares strong sequence similarity with aminopeptidase C from Streptococcus thermophilous, Lactobacillus lactis, Lactobacillus helveticus, and with a cysteine proteinase from Saccharomyces cerevisiae. Polymerase chain reaction primers were synthesized based on the DNA sequence of the aminopeptidase gene. A 90 bp product was apparent with all L. monocytogenes strains tested but not with other species of Listeria or other bacterial genera. The PCR assay, which is performed directly from whole bacterial cells, does not involve DNA purification and can be conducted in 4 h. It provided positive identification of L. monocytogenes in mixed culture.

Decrease in occurrence of fast startle responses after selective Mauthner cell ablation in goldfish (Carassius auratus).

A single action potential in one of a pair of reticulospinal neurons, the Mauthner cells, precedes a short-latency electromyographic response of the trunk and tail musculature on the opposite side of the body and a fast startle response in goldfish. It has been postulated that not only the Mauthner cell, but also an array of neurons can trigger or participate in fast startle responses (Eaton et al. 1991). We have selectively ablated the Mauthner cells in goldfish to study how neurons of the brainstem fast startle response network interact. The probability of eliciting a fast startle response was significantly less in fish with double Mauthner cell ablations, as compared to the responsiveness of control fish. The finding that there is a significant decrease in the occurrence of fast startle responses in animals with no Mauthner cells, implies that the Mauthner cell may play a role in triggering the involvement of the other network elements in fast startle responses. We hypothesize that Mauthner cell activation may be important in bringing those reticulospinal neurons that are "primed" by the behavioral context to threshold and provides the basis for studies focused on the interactive nature of the brainstem startle response network.

Purification, amino acid sequence and mode of action of bifidocin B produced by Bifidobacterium bifidum NCFB 1454.

Bifidocin B produced by Bifidobacterium bifidum NCFB 1454 was purified to homogeneity by a rapid and simple three step purification procedure which included freeze drying, Micro-Cel adsorption/desorption and cation exchange chromatography. The purification resulted in 18% recovery and an approximately 1900-fold increase in the specific activity and purity of bifidocin B. Treatment with bifidocin B caused sensitive cells to lose high amounts of intracellular K+ ions and u.v.-absorbing materials, and to become more permeable to ONPG. Bifidocin B adsorbed to the Gram-positive bacteria but not the Gram-negative bacteria tested. Its adsorption was pH-dependent but not time-dependent. For sensitive cells, the adsorption and lethal action of bifidocin B was very rapid. In 5 min, 95% of bifidocin B adsorbed onto sensitive cells. Several salts inhibited the binding of bifidocin B, which could be overcome by increasing the amount of bifidocin B added. Pre-treatment of sensitive cells and cell walls with detergents, organic solvents or enzymes did not cause a reduction in subsequent cellular binding of bifidocin B, but cell wall preparations treated with methanol:chloroform and hot 20% (w/v) TCA lost the ability to adsorb bifidocin B. Also, the addition of purified heterologous lipoteichoic acid to sensitive cells completely blocked the adsorption of bifidocin B. The amino acid sequence indicated that the bacteriocin contained 36 residues. N-terminal amino acid sequence analysis yielded a sequence of KYYGNGVTCGLHDCRVDRGKATCGIINNGGMWGDIG. Curing experiments with 20 micrograms ml-1 acriflavine yielded cell derivatives that no longer produced bifidocin B but retained immunity to bifidocin B. Production of bifidocin B, but not immunity to bifidocin B, was associated with a plasmid of about 8 kb in this strain.

Relationships between dioxins in soil, air, ash, and emissions from a municipal solid waste incinerator emitting large amounts of dioxins.

The Columbus Municipal Waste-to-Energy (Columbus WTE) facility in Columbus, Ohio, began operation in June, 1983 and ceased operation in December, 1994. During its operation, it was estimated to have released nearly 1,000 grams of dioxin Toxic Equivalents (TEQs) per year. This compares to a 1994 estimate of 9,300 g TEQ/yr from all sources emitting dioxins into the air in the United States (EPA, 1994), and to total releases of dioxins near or below 1,000 grams TEQ/Yr for England (Eduljee and Keyke, 1996), Belgium (Wevers and De Fre, 1995), and West Germany (Fiedler and Hutzinger, 1992). Because of the magnitude of emissions from this single source, studies were undertaken to evaluate the impacts to air and soil near the incinerator. This paper presents analyses evaluating dioxin concentrations and profiles in four media: stack gas, ambient air within 3 km of the incinerator, soil samples up to 8 km from the incinerator, and incinerator ash. Principal findings include: 1) an "incinerator signature" profile, as defined by stack gas emissions, was found in the ash and in subsets of the air and soil matrices, 2) soil concentrations declined from directly outside the incinerator property to the city at large, 3) an urban background soil concentration of dioxin Toxic Equivalents (TEQs) was estimated at 4 pg/g, while concentrations generally within 2 km of the incinerator ranged from 4-60 pg TEQ/g, 4) an urban background air concentration was estimated at 0.05 pg TEQ/m3, while air concentrations at a specific location about 2 km in the downwind direction of the incinerator had concentrations of 0.17 and 0.35 pg TEQ/m3 during two sampling dates, 5) analysis of the soil monitoring data in combination with the stack test data suggests that less than 2% of emitted dioxins can be found in the soil near the incinerator, and 6) principal component analysis suggests that the fraction of total concentration of OCDD is the single feature explaining most of the variation of all concentration profiles. This paper discusses these and other findings, and their implications.