Your browser doesn't support javascript.
loading
Show: 20 | 50 | 100
Results 1 - 5 de 5
Filter
Add more filters










Publication year range
1.
Article in English | WPRIM (Western Pacific) | ID: wpr-776869

ABSTRACT

Isoflavones are widely consumed by people around the world in the form of soy products, dietary supplements and drugs. Many isoflavones or related crude extracts have been reported to exert pain-relief activities, but the mechanism remains unclear. Voltage-gated sodium channels (VGSCs) play important roles in excitability of pain sensing neurons and many of them are important nociceptors. Here, we report that several isoflavones including 3'-methoxydaidzein (3MOD), genistein (GEN) and daidzein (DAI) show abilities to block VGSCs and thus to attenuate chemicals and heat induced acute pain or chronic constriction injury (CCI) induced pain hypersensitivity in mice. Especially, 3MOD shows strong analgesic potential without inducing addiction through inhibiting subtypes Na1.7, Na1.8 and Na1.3 with the IC of 181 ± 14, 397 ± 26, and 505 ± 46 nmol·L, respectively, providing a promising compound or parent structure for the treatment of pain pathologies. This study reveals a pain-alleviating mechanism of dietary isoflavones and may provide a convenient avenue to alleviate pain.


Subject(s)
Animals , Humans , Male , Mice , Analgesics , Chemistry , Isoflavones , Chemistry , Mice, Inbred C57BL , Pain , Drug Therapy , Genetics , Metabolism , Voltage-Gated Sodium Channel Blockers , Voltage-Gated Sodium Channels , Genetics , Metabolism
2.
Article in English | WPRIM (Western Pacific) | ID: wpr-812127

ABSTRACT

The present study was designed to investigate the antimalarial activity of synthetic hepcidin and its effect on cytokine secretion in mice infected with Plasmodium berghei. The mice were infected with P. berghei intravenously and treated with hepcidin according to 4-day suppression test and Rane's test. The serum levels of interleukins (IL-1β, IL-2, IL-6, IL-10, IL-12p70, and IL-17A), tumor necrosis factor-α (TNF-α), and interferon-γ (IFN-γ) in the experimental mice were determined using a cytometric bead array (CBA) kit. The survival rate of the infected mice was also registered. Additionally, the serum iron, alanine transaminase (ALT), aspartate transaminase (AST), and total bilirubin (BIL) were detected to evaluate liver functions. Hepcidin exerted direct anti-malarial function in vivo and increased survival rate in a dose-dependent manner. In addition, the secretion of T helper cell type 1 (Th1), Th2, and Th17 cytokines, TNF-α, and IFN-γ were inhibited by hepcidin. In conclusion, our results demonstrated that synthetic hepcidin exerts in vivo antimalarial activity and possesses anti-inflammatory function, which provides a basis for future design of new derivatives with ideal anti-malarial activity.


Subject(s)
Animals , Humans , Male , Mice , Antimalarials , Pharmacology , Disease Models, Animal , Drug Evaluation, Preclinical , Hepcidins , Pharmacology , Interleukin-10 , Allergy and Immunology , Interleukin-17 , Allergy and Immunology , Malaria , Drug Therapy , Allergy and Immunology , Mortality , Parasitology , Plasmodium berghei , Genetics , Metabolism
3.
Article in English | WPRIM (Western Pacific) | ID: wpr-812580

ABSTRACT

The present study was designed to search for compounds with analgesic activity from the Schizophyllum commune (SC), which is widely consumed as edible and medicinal mushroom world. Thin layer chromatography (TLC), tosilica gel column chromatography, sephadex LH 20, and reverse-phase high performance liquid chromatography (RP-HPLC) were used to isolate and purify compounds from SC. Structural analysis of the isolated compounds was based on nuclear magnetic resonance (NMR). The effects of these compounds on voltage-gated sodium (NaV) channels were evaluated using patch clamp. The analgesic activity of these compounds was tested in two types of mouse pain models induced by noxious chemicals. Five phenolic acids identified from SC extracts in the present study included vanillic acid, m-hydroxybenzoic acid, o-hydroxybenzeneacetic acid, 3-hydroxy-5-methybenzoic acid, and p-hydroxybenzoic acid. They inhibited the activity of both tetrodotoxin-resistant (TTX-r) and tetrodotoxin-sensitive (TTX-s) NaV channels. All the compounds showed low selectivity on NaV channel subtypes. After intraperitoneal injection, three compounds of these compounds exerted analgesic activity in mice. In conclusion, phenolic acids identified in SC demonstrated analgesic activity, facilitating the mechanistic studies of SC in the treatment of neurasthenia.


Subject(s)
Animals , Humans , Mice , Analgesics , Chemistry , Hydroxybenzoates , Chemistry , Neurasthenia , Drug Therapy , Genetics , Metabolism , Schizophyllum , Chemistry , Voltage-Gated Sodium Channel Blockers , Chemistry , Voltage-Gated Sodium Channels , Genetics , Metabolism
4.
Article in English | WPRIM (Western Pacific) | ID: wpr-812578

ABSTRACT

The present study was designed to identify immunomodulatory components from the leech salivary gland of Haemadipsa sylvestris. The Sephadex G-50, Resource(TM) S column chromatography and reverse-phase high performance liquid chromatography (RP-HPLC) were used to isolate and purify the salivary gland extracts (SGE). Structural analysis of isolated compounds was based on Edman degradation and matrix assisted laser desorption ionization time-of-flight mass spectrometer (MALDI-TOF-MS). The cDNA encoding the precursor of the compound was cloned from the cDNA library of the salivary gland of H. sylvestris. The levels of inflammatory mediators, including tumor necrosis factor-α (TNF-α), interferon γ (IFN-γ), interleukin-6 (IL-6), and monocyte chemotactic protein-1 (MCP-1) were assayed using an enzyme-linked immunosorbent assay (ELISA). The effects on cell proliferation and cell viability were observed using MTT assay. A novel neuropeptide Y (Neuropeptide Y-HS) from the leech salivary gland of H. sylvestris was purified and characterized. It was composed of 36 amino acid residues and the amino acid sequence was determined to be FLEPPERPAVFTSVEQMKSYIKALNDYYLLLGRPRF-NH2, containing an amidated C-terminus. It showed significant inhibitory effects on the production of inflammatory cytokines including TNF-α, IFN-γ, IL-6, and MCP-1. Neuropeptide Y was identified from leeches for the first time. The presence of neuropeptide Y-HS in leech salivary gland may help get blood meal from hosts and inhibit inflammation.


Subject(s)
Animals , Mice , Amino Acid Sequence , Immunologic Factors , Chemistry , Genetics , Inflammation , Drug Therapy , Allergy and Immunology , Interferon-gamma , Allergy and Immunology , Interleukin-6 , Allergy and Immunology , Leeches , Chemistry , Mass Spectrometry , Molecular Sequence Data , Neuropeptide Y , Chemistry , Genetics , Peptide Mapping , Salivary Glands , Chemistry , Tumor Necrosis Factor-alpha , Allergy and Immunology
5.
National Journal of Andrology ; (12): 494-499, 2015.
Article in Chinese | WPRIM (Western Pacific) | ID: wpr-276070

ABSTRACT

<p><b>OBJECTIVE</b>To explore the role of the basic fibroblast growth factor (bFGF) in the directional differentiation of bone marrow mesenchymal stem cells (BMSCs) into Leydig cells.</p><p><b>METHODS</b>After purification and identification, we inoculated the third-generation BMSCs of SD rats onto a six-orifice board and then randomly divided them into groups A (normal saline control), B (human chorionic gonadotropin [hCG] + platelet-derived growth factor [PDGF] induction), C (hCG + PDGF + 5.0 ng/ml bFGF induction), D (hCG + PDGF + 10.0 ng/ml bFGF induction), and E (hCG + PDGF + 20.0 ng/ml bFGF induction). On the 7th, 14th and 21st day of induction, we observed the morphological changes of the cells and measured the level of testosterone (T) and expression of 3 beta hydroxy steroid dehydrogenase (3β-HSD) in the supernatant by immunofluorescence staining.</p><p><b>RESULTS</b>After induction, the BMSCs of groups B, C, D, and E exhibited microscopic features of enlarged size, inter-connection, long-shuttle or irregular shape, adherent growth, and large round nuclei, all characteristic of Leydig cells. With the prolonging of time and enhanced concentration of bFGF, gradual increases were observed in the T level and the count of 3β-HSD-positive BMSCs in the four induction groups, with statistically significant differences between group B and groups C, D, and E (P < 0.05), as well as between group C and groups D and E (P < 0.05), but not between D and E (P > 0.05).</p><p><b>CONCLUSION</b>The bFGF has an obvious promoting effect in the in vitro induced differentiation of rat BMSCs into Leydig cells.</p>


Subject(s)
Animals , Humans , Male , Rats , Bone Marrow Cells , Cell Biology , Metabolism , Cell Differentiation , Cells, Cultured , Chorionic Gonadotropin , Metabolism , Fibroblast Growth Factor 2 , Pharmacology , Leydig Cells , Cell Biology , Mesenchymal Stem Cells , Cell Biology , Metabolism , Random Allocation , Rats, Sprague-Dawley , Testosterone , Metabolism
SELECTION OF CITATIONS
SEARCH DETAIL
...