RESUMO
OBJECTIVE: To clarify the effects of ionizing radiation and to dispel fear associated with the use of radioactivity in medical diagnosis and therapy. DESIGN: Studies of populations in geographic areas of increased cosmic radiation and high natural background radiation, radiation-exposed workers, patients with medical exposure to radioactivity, and accidental exposure are reviewed. RESULTS: No reproducible evidence shows harmful effects associated with increases in background radiation of 3 to 10 times the usual levels. American military personnel who participated in nuclear testing had no increase in leukemia or other cancers. Among 22,000 patients with hyperthyroidism treated with 131I (mean dose, 10 rem), no increased incidence of leukemia was found in comparison with 14,000 similar patients who received other treatment. A 20-year follow-up of 35,000 patients who underwent 131I uptake tests for evaluation of thyroid function revealed that those studied for other than a suspected tumor had only 60% of the thyroid cancers expected in a control group. Although early studies showed that high exposures to miners to radon and its daughters resulted in a substantial increase in lung cancer, no evidence exists for an increase in lung cancer among nonsmokers exposed to increased radon levels in the home. CONCLUSION: Perhaps the association of radiation with the atomic bomb has created a climate of fear about the possible dangers of radiation at any level; however, no evidence indicates that current radiation exposures associated with medical usage are harmful.
Assuntos
Efeitos da Radiação , Acidentes de Trabalho , Radiação de Fundo , Exposição Ambiental , Humanos , Reatores Nucleares , Exposição Ocupacional , Radioisótopos/efeitos adversos , Radioterapia/efeitos adversos , Radônio , UcrâniaRESUMO
Evolutionary history suggests that the marsupials entered South America from North America about 75 million years ago and subsequently dispersed into Australia before the separation between South America and Antarctica-Australia. A question of interest is whether marsupial peptides resemble the corresponding peptides of Old or New World mammals. Previous studies had shown that "little" gastrin of the North American marsupial, the opossum, is identical in length to that of the New World mammals, the guinea pig and chinchilla. In this report, we demonstrate that opossum cholecystokinin octapeptide, like that of the Australian marsupials, the Eastern quoll and the Tamar wallaby, is identical to the cholecystokinin octapeptide of Old World mammals and differs from that of the guinea pig and chinchilla. However, opossum vasoactive intestinal polypeptide differs from the usual Old World mammalian vasoactive intestinal polypeptide in five sites: [sequence; see text].
Assuntos
Gambás/fisiologia , Sincalida/química , Peptídeo Intestinal Vasoativo/química , Sequência de Aminoácidos , Animais , Química Encefálica , Dados de Sequência Molecular , Alinhamento de Sequência , Sincalida/isolamento & purificação , Peptídeo Intestinal Vasoativo/isolamento & purificaçãoRESUMO
The amino acid sequences of the gastroenteropancreatic peptides of Old World mammals are generally well-conserved. However, only the glucagons and vasoactive intestinal polypeptides (VIP) have been shown to be identical among the species studied to date. Rhesus monkey (Macaca mulatta) insulin has been shown to be identical with human insulin. The question addressed in this study is whether other gastroenteropancreatic peptides are identical to the human peptides. Purification and sequencing of glucagon, pancreatic polypeptide, VIP and insulin confirmed their identity with the corresponding human peptides. However, the 17 amino acid monkey gastrin is identical to dog gastrin and differs from human gastrin by substitution of methionine for leucine at position 5 from the N-terminus and alanine for glutamic acid in position 10. If additional rhesus monkey tissues become available, it would be of interest to determine whether other gastrointestinal peptides also differ from the corresponding human peptides.
Assuntos
Hormônios Gastrointestinais/genética , Macaca mulatta/metabolismo , Hormônios Pancreáticos/genética , Sequência de Aminoácidos , Animais , Cromatografia Líquida de Alta Pressão , Cães , Humanos , Macaca mulatta/genética , Dados de Sequência Molecular , Fragmentos de Peptídeos/análise , Homologia de Sequência do Ácido Nucleico , Especificidade da EspécieRESUMO
It was reported two decades ago that insulin was not detectable in the glucose-stimulated state in Saimiri sciurea, the New World squirrel monkey, by a radioimmunoassay system developed with guinea pig anti-pork insulin antibody and labeled pork insulin. With the same system, reasonable levels were observed in rhesus monkeys and chimpanzees. This suggested that New World monkeys, like the New World hystricomorph rodents such as the guinea pig and the coypu, might have insulins whose sequences differ markedly from those of Old World mammals. In this report we describe the purification and amino acid sequences of squirrel monkey insulin and glucagon. We demonstrate that the substitutions at B29, B27, A2, A4, and A17 of squirrel monkey insulin are identical with those previously found in another New World primate, the owl monkey (Aotus trivirgatus). The immunologic cross-reactivity of this insulin in our immunoassay system is only a few percent of that of human insulin. Squirrel monkey glucagon is identical with the usual glucagon found in Old World mammals, which predicts that the glucagons of other New World monkeys would not differ from the usual Old World mammalian glucagon. It appears that the peptides of the New World monkeys have diverged less from those of the Old World mammals than have those of the New World hystricomorph rodents. The striking improvements in peptide purification and sequencing have the potential for adding new information concerning the evolutionary divergence of species.
Assuntos
Glucagon/genética , Insulina/genética , Sequência de Aminoácidos , Animais , Aotus trivirgatus , Bovinos , Cromatografia Líquida de Alta Pressão , Glucagon/isolamento & purificação , Insulina/isolamento & purificação , Substâncias Macromoleculares , Dados de Sequência Molecular , Saimiri , Homologia de Sequência do Ácido NucleicoRESUMO
Molecular cloning of cholecystokinin (CCK) mRNA from porcine brain and gut has demonstrated that CCK is synthesized as an identical precursor in both tissues. The sequence for porcine CCK-58 predicted from CCK cDNA was identical with the amino acid sequence of the peptide purified from different lots of animals. However one group did report that there were differences in the N-terminus of CCK-58 purified from the intestines of two different lots of mongrel dogs. In the current report it is demonstrated that the amino acid sequences of CCK-58 purified separately from three bovine brains are identical through the first 19 N-terminal amino acid residues. The peptides were sequenced for ten additional steps and were shown to be identical with the previously reported sequences for the N-terminus of CCK-39. The N-terminus of bovine CCK-58 has the following sequence: AVPRVDDEPRAQLGALLAR.
Assuntos
Colecistocinina/isolamento & purificação , Sequência de Aminoácidos , Animais , Química Encefálica , Bovinos , Colecistocinina/química , Clonagem Molecular , Cães , Dados de Sequência Molecular , Homologia de Sequência do Ácido Nucleico , SuínosRESUMO
1. "Little" gastrins from most mammalian species are 17 amino acid peptides and the precursor "big" gastrins are 34 amino acid peptides. 2. "Little" gastrins of the New World hystricomorphs, guinea-pig and chinchilla, are 16 amino acid peptides due to deletion of a glutamic acid in the region 6-9 from their NH2-terminus and the corresponding "big" gastrins are 33 amino acid peptides. 3. Antral gastrins from the opossum, a New World marsupial, have a glutamic acid deletion in the same region as the hystricomorph gastrins. 4. Opossum "big" gastrin is a 33 amino acid peptide with the following sequence: less than ELGPQDLPYLTADLSKKQGPWLEEEEAYGWMDF#.
Assuntos
Gastrinas/isolamento & purificação , Gambás/fisiologia , Precursores de Proteínas/isolamento & purificação , Sequência de Aminoácidos , Animais , Cromatografia Líquida de Alta Pressão , Gastrinas/genética , Dados de Sequência Molecular , Precursores de Proteínas/genética , Homologia de Sequência do Ácido Nucleico , Especificidade da EspécieRESUMO
Pancreatic hormones have been purified from the opossum, a New World marsupial. Opossum insulin contains a Leu substitution at the N-terminus of the B-chain in place of the Phe that is generally present in mammalian insulins. In addition, there are two other amino acid substitutions in the opossum insulin A-chain (positions 8 and 18) compared to pig insulin. Opossum glucagon is identical to chicken glucagon with both differing from the usual mammalian glucagon by Ser in place of Asn at its penultimate C-terminal position. Opossum PP differs from the porcine peptide in only 3 sites (position 3, 19 and 30).
Assuntos
Glucagon , Insulina , Gambás , Polipeptídeo Pancreático , Sequência de Aminoácidos , Animais , Glucagon/isolamento & purificação , Insulina/isolamento & purificação , Mamíferos , Dados de Sequência Molecular , Polipeptídeo Pancreático/isolamento & purificação , Radioimunoensaio , Especificidade da Espécie , SuínosRESUMO
The rat has been a useful model for studying neuronal and metabolic abnormalities associated with fetal and neonatal hypothyroidism produced by treatment of the mother with antithyroid medication. The neonates are then maintained on this medication via the mother's milk until weaning and subsequently through the drinking water. We have determined the concentrations and contents of immunoreactive cholecystokinin (CCK) and vasoactive intestinal peptide (VIP) in the brain and gut of groups of rats exposed to antithyroid medication from day 16 of gestation. The neonates were sacrificed at 2, 4, 8 and 12 weeks. Compared to controls total body weight was greatly reduced in methimazole (MMI)-treated rats, all of whom were hypothyroid as evidenced by marked reduction of T4 and increase in TSH. Discontinuation of MMI-treatment after 8 weeks resulted in normalization of T4 and TSH and a dramatic weight gain but at 12 weeks the brain weights of the MMI-treated rats were reduced by 17% and the brain contents, of CCK and VIP were similarly reduced. Tissue weights throughout the gut were 1/2 or less than those of control rats. Since VIP but not CCK concentrations in the gut of MMI-treated animals were significantly greater than those of the control animals, it would appear that there was greater loss of mucosal tissue with its endocrine content of CCK than of neuronal tissue with its greater content of VIP.(ABSTRACT TRUNCATED AT 250 WORDS)
Assuntos
Animais Recém-Nascidos/metabolismo , Química Encefálica/efeitos dos fármacos , Colecistocinina/metabolismo , Sistema Digestório/metabolismo , Hipotireoidismo/metabolismo , Peptídeo Intestinal Vasoativo/metabolismo , Envelhecimento/metabolismo , Animais , Peso Corporal/efeitos dos fármacos , Sistema Digestório/efeitos dos fármacos , Feminino , Hipotireoidismo/induzido quimicamente , Metimazol/farmacologia , Tamanho do Órgão/efeitos dos fármacos , Gravidez , Radioimunoensaio , Ratos , Ratos EndogâmicosRESUMO
Previous studies have shown that pig intestine contains a 69 amino acid glucagon (glicentin) as well as a 37 amino acid glucagon (oxyntomodulin). In pig pancreas the 29 amino acid glucagon predominates. Since glucagon is thought to be expressed from a single gene in mammals, these differences in molecular forms indicate differential posttranslational processing of the glucagon precursor by different tissues. In the current study glucagon immunoreactivity (IR) was separately purified from dog pancreas, stomach mucosa and ileum mucosa. Purification and sequence analysis of the different tissue glucagons show that dog pancreas and stomach mucosa contain glucagon-29 while ileum mucosa contains glucagon-37 and glucagon-69. The latter is the major form present with glucagon-37 accounting for only 10-20% of the total ileum glucagon content. The N-terminal 32 amino acid portion of dog glucagon-69 differs at 6 sites from pig glucagon-69: RSLQDTEEKSRSFSAPQTEPLNDLDQMNEDKR... The C-terminal glucagon-37 is identical to pig oxyntomodulin.
Assuntos
Glucagon/análise , Íleo/análise , Pâncreas/análise , Estômago/análise , Sequência de Aminoácidos , Animais , Cães , Glucagon/imunologia , Glucagon/isolamento & purificaçãoRESUMO
Patients with mild or early non-insulin-dependent diabetes mellitus often display a delay in insulin response followed by late hyperinsulinemia during oral glucose tolerance testing. Those patients with long-standing disease or elevations of fasting plasma glucose in excess of 140 mg/dl are generally hypoinsulinemic in response to an oral glucose tolerance test. Diabetic patients who do not have an acute response to intravenous glucose may have normal responses to intravenous tolbutamide or intravenous arginine, suggesting that delayed responsiveness to glucose is not due to decreased pancreatic insulin content. An association between hyperinsulinemia and hypertension has been suggested by recent studies from several laboratories. In a homogeneous population of men who suffered traumatic bilateral above-the-knee amputation in the Vietnam War with subsequent development of obesity, it was shown that there was strong correlation between hypertension and hyperinsulinemia during oral glucose tolerance testing despite only mild glucose intolerance. In addition, a subset of hypertensive women who were in their third trimester of pregnancy were markedly hyperinsulinemic during oral glucose tolerance testing in the absence of any abnormalities of glucose tolerance. Thus, the relationship between hyperinsulinemia and hypertension, and the possible reasons for this relationship, are fields of active investigation at present.
Assuntos
Diabetes Mellitus Tipo 2/sangue , Insulina/sangue , Doença Aguda , Glicemia/metabolismo , Humanos , Hipertensão/sangue , Obesidade/sangueRESUMO
Cholecystokinin octapeptides (CCK8s) have been purified from methanol extracts of two brains from each of two Australian marsupials, Tammar Wallaby and Eastern Quoll, containing 3 nmol and 2 nmol of the peptides, respectively. Immunoreactive CCK was concentrated on QMA SepPak cartridges and purified by two successive HPLC steps on Nova C18 radial-pak cartridges. The sequence of each of the peptides is identical with that previously reported for Old World mammals (DYMGWMDF). This is in contrast to the previously reported sequence for CCK8 from the South American hystricomorphs, guinea pig and chinchilla, which differs in a substitution of valine for methionine in position 3 from the NH2-terminus. Although evolutionary history suggests that marsupials migrated from South America into Australia before the two continents separated, this peptide resembles that found in Old World mammals rather than that of South American hystricomorphs. Such molecular data are useful in assessing phylogenetic relationships among taxa.
Assuntos
Química Encefálica , Marsupiais/metabolismo , Sincalida/isolamento & purificação , Sequência de Aminoácidos , Animais , Austrália , Cromatografia Líquida de Alta Pressão , Especificidade da EspécieRESUMO
Glucagon is a 29 amino acid peptide that is generally highly conserved. Among mammalian glucagons the only one that has been shown to differ significantly is that of the guinea pig which differs from the others in 5 of the 9 COOH-terminus amino acids. The amino acid content and partial sequencing of chicken glucagon had been reported earlier. This report describes the purification and complete amino acid sequencing of chicken glucagon and demonstrates that it differs from the usual mammalian glucagon by the replacement of asparagine at position 28 with serine. Chicken glucagon is indistinguishable from porcine glucagon in the rat liver receptor assay system.